PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco002145.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 630aa    MW: 69500.2 Da    PI: 5.4957
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco002145.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.4e-093854221954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  Aco002145.1 385 FEHflHPYPKDSEKIMLARQTGLTRSQISNWFINARVR 422
                  665559******************************88 PP

2BELL123.96.4e-40248319172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  erqelq+k +kLl +l++Vd+rYk+y++q+q+v+ssF+++ag gsakpYt++Al++iSrhFrcLkd i +qi
  Aco002145.1 248 ERQELQNKLTKLLAMLDQVDRRYKHYYHQMQIVVSSFDVIAGSGSAKPYTAVALQTISRHFRCLKDTINDQI 319
                  79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-58169317IPR006563POX domain
PfamPF075264.6E-50175315IPR006563POX domain
PROSITE profilePS5007112.357363426IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-28365438IPR009057Homeodomain-like
SMARTSM003897.0E-10366430IPR001356Homeobox domain
CDDcd000865.22E-13366427No hitNo description
SuperFamilySSF466891.71E-17367433IPR009057Homeodomain-like
PfamPF059204.3E-18383422IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MATYFSGAAN QREMPALCSR DAGSEPYPSQ SIMGNLLYLN HPSSGAFPEF TGIAPAATSQ  60
DSSYSDLKDG RNEMFMQMIG ASQNGVGDLI QNPNPIADET HLGMQLNFGI LNGQNLPLQQ  120
ANFPPVHGQG LSLSLGTHIM APPFQYAMVN GGIYGPHGDD DARSKFMHSE VSRTISNSKY  180
LKAAQELLDE VVNVRKDLKQ KVDKNQNANN NSAGVGDCKE SDGASKSDGI SSNSREQNAQ  240
SNELSPSERQ ELQNKLTKLL AMLDQVDRRY KHYYHQMQIV VSSFDVIAGS GSAKPYTAVA  300
LQTISRHFRC LKDTINDQIR SIRKGLGEEE SSASKGGGLT RLRYIDQQLR QQRAVQQFGM  360
IHQNAWRPQR GLPENSVSIL RAWLFEHFLH PYPKDSEKIM LARQTGLTRS QISNWFINAR  420
VRLWKPMIED MYKEETGDAE MDSNSSSDNV PRSKDEIGSS EEREDLKSSA TERGQTSQFN  480
ESKTNNSEID MGGAAIGFPS ETTADDSFMN LMLKDQRLSE RDSGLLHDAV GQKPNESGRF  540
MAYQMANLGN LASLGNYGNG SVSLTLGLQH FDGALHVPNT QEAFSEVRGE DIYGNAPQIG  600
VGSSEFDSMN PMDQRQRFEP SPLLHDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16372429158Homeobox protein Meis1
4xrs_B1e-16372429158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6648392e-46KM664839.1 Ananas bracteatus clone 49844b microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963319.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004963320.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004963321.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A0D9Y1T20.0A0A0D9Y1T2_9ORYZ; Uncharacterized protein
STRINGSi021436m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-119BEL1-like homeodomain 6